SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024CIX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024CIX8
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily PX domain 5.49e-26
Family PX domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024CIX8
Sequence length 241
Comment (tr|A0A024CIX8|A0A024CIX8_9TELE) SH3 and PX domain-containing 3-like protein {ECO:0000313|EMBL:AHZ35036.1} OX=32482 OS=Xiphophorus nigrensis (Panuco swordtail). GN=SH3PX3 OC=Poeciliinae; Xiphophorus.
Sequence
AESYTIEMGSLGPQWKANPRPFICSIEDPTKQTKFKGIKTYISYRVTPSHIGRPVYRRYK
HFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMNHMTSHPVLSQYEG
FEHFLMCADDKQWKLGKRRAEKDEMVGAHFMLTLQIPNEHQDLQDVEERVDNFKTFAKKM
DDSVMQLTHVASELVRKHLGGFRKEFQRLGNAFQSISQAFTLDPPYRSDALNNAISHTGR
T
Download sequence
Identical sequences A0A024CIH9 A0A024CIJ9 A0A024CIL5 A0A024CIX8 A0A024CIZ7 A0A024CJ17 A0A024CJ28 A0A024CKL2 A0A024CKN1 A0A024CKP2 A0A024CKP9 A0A068LBB9 A0A068LBD2 A0A068LDX9 A0A068LHH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]