SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024EDA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024EDA2
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.05e-43
Family SMI1/KNR4-like 0.000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024EDA2
Sequence length 135
Comment (tr|A0A024EDA2|A0A024EDA2_9PSED) Uncharacterized protein {ECO:0000313|EMBL:AHZ70591.1} KW=Complete proteome OX=1147786 OS=Pseudomonas mandelii JR-1. GN=OU5_3512 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEIIEQLREANEPVPVPLELPDEDQIVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVDRSMIPICQDGDNYYLVEEDGTVVLWLAEEELVAEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A024EDA2 A0A191Z2T8 A0A1H2HHL1 A0A1S8H321
WP_010465379.1.12362 WP_010465379.1.19334 WP_010465379.1.27599 WP_010465379.1.55965 WP_010465379.1.75244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]