SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024EDF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024EDF7
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 2.09e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024EDF7
Sequence length 163
Comment (tr|A0A024EDF7|A0A024EDF7_9PSED) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1147786 OS=Pseudomonas mandelii JR-1. GN=OU5_3541 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPDLLFQYAEEAEARGIEV
IIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQMPAGIPVATLAIGKAG
AINAALLSASILGAKHPQFHAVLKKFRAEQTDSVLENPDPRIA
Download sequence
Identical sequences A0A024EDF7 A0A059KZQ4 A0A0F4VB53 A0A1H2HIS2 A0A1P8EUN7 A0A1S8H310 W6V7Y2
WP_008150032.1.12362 WP_008150032.1.19334 WP_008150032.1.27599 WP_008150032.1.36576 WP_008150032.1.43699 WP_008150032.1.55513 WP_008150032.1.55965 WP_008150032.1.91498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]