SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024FLZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024FLZ3
Domain Number 1 Region: 44-118
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000000034
Family Cystatins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024FLZ3
Sequence length 121
Comment (tr|A0A024FLZ3|A0A024FLZ3_9FLAO) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component {ECO:0000313|EMBL:BAO77593.1} KW=Complete proteome; Reference proteome OX=754409 OS=Winogradskyella sp. PG-2. GN=WPG_3363 OC=Flavobacteriaceae; Winogradskyella.
Sequence
MIKNIIKVSLLATAVLVFVKCKEDQKVTPTENTEKIVEQKQHRVGGWQSIDVNDTVKDLA
NFVIADKQITSPLKKLSNASTQIVSGKNYKFDMLLENGELWTAQVYVNIQKEKSVTKLEK
K
Download sequence
Identical sequences A0A024FLZ3
WP_045474636.1.13872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]