SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024FU11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024FU11
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily L domain-like 0.0000000017
Family U2A'-like 0.0023
Further Details:      
 
Domain Number 2 Region: 242-278
Classification Level Classification E-value
Superfamily SAP domain 0.0000000659
Family SAP domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024FU11
Sequence length 280
Comment (tr|A0A024FU11|A0A024FU11_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI10491.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_102340 OC=Albugo.
Sequence
MLLMHTNHISRIQPHLEESIGNLQVLILTNNKIVNLTEIDSLIGFRKLDILSPLHSFIVY
ITIVLITKRKFYREYVIHKLPQLRVLDYAKIRPAERDAATRFFSSENGQTFEKEMREEPG
DTKSSKPEELTVLAANEPKRSVKLHANVSTTSTVTITTVETIQSTELMKMVDEANGTICD
TKDVKMEQIDTSVSVTQTSQETEAVQRTPTRKTRNAKSRNDNNVEMMDASPSEMVYTPSK
PIEMMTVPILRKELKKLNLPTTGLKAELVQRLREVLDRQN
Download sequence
Identical sequences A0A024FU11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]