SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024G2T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024G2T2
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily eIF4e-like 5.62e-39
Family Translation initiation factor eIF4e 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024G2T2
Sequence length 196
Comment (tr|A0A024G2T2|A0A024G2T2_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI40946.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_017300 OC=Albugo.
Sequence
MGTDQDDELYPLETAWSIWELREQQKNLSYADTLFKMCTFKTVGKFWGYWNNILKPSQVL
FDGYTRKRIGDRYVESFAVFREGIVPEWEDPQNRSGGEWSIRKELTGPILDKLWEITVLG
AIGEQLDEGDEITGVRVIHKNKKDKKDMVNFYRFEIWLRTQDRTKANQVLNKFLKLVNGS
IDGDHWTTHECQYKNH
Download sequence
Identical sequences A0A024G2T2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]