SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024G6B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024G6B0
Domain Number 1 Region: 26-120
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000000207
Family Cystatins 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024G6B0
Sequence length 279
Comment (tr|A0A024G6B0|A0A024G6B0_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI41845.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_026290 OC=Albugo.
Sequence
MKYKMNANFLAFASVILNAIARSEVLPGGWKDNKVDAESENRLMRVLTSALTSSNVLVPS
MCINKVVSVKSQVVAGMSYEYKVEGCNAISDLGLQKCVTCEKPKVYVVLVYERAWEHAEE
LISISEEADDLTSKSADSGQESESAHMEPETNGINDEEKAQIADWVSQNKLNRYGDQDGT
SYAGGNPLFDENAGKFIDYYDYMLDKFPTRPWRHTVVRAQSSVSNDSLQFMAETEGKNKW
TFGVSAILVASVFGAVVAMVMVFRTQRTQRRHAYASISG
Download sequence
Identical sequences A0A024G6B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]