SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GAN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GAN6
Domain Number 1 Region: 10-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0037
Further Details:      
 
Domain Number 2 Region: 58-126
Classification Level Classification E-value
Superfamily EF-hand 0.00000288
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024GAN6
Sequence length 133
Comment (tr|A0A024GAN6|A0A024GAN6_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI43615.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_043990 OC=Albugo.
Sequence
MDVNRIFSAEQIAVPSDLPLILKEWTKAVFREHPSDLLEFSLEWFKAGEKAIQAEIIKNK
QLSLLCEAFDARTASVKMQKKDFKAFILDDLGLKIPENELEEVLLDFDTGNKGFLELDEI
VDWVTHRREHGVF
Download sequence
Identical sequences A0A024GAN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]