SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GB20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GB20
Domain Number 1 Region: 5-36
Classification Level Classification E-value
Superfamily WW domain 0.00000000312
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024GB20
Sequence length 240
Comment (tr|A0A024GB20|A0A024GB20_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI43522.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_043060 OC=Albugo.
Sequence
MASAGLTPPWRAYKTAEGKEYYYNTQTKVTTWDHPTSGKNATKRDNKHISGVRRTSSSNN
SKQQSITRSSSVEGAGRGGLLAQIQQGAKLKKVEVKEKSSLSVTGNENESCESSNDTGSM
DGMSAMLNAIRSGGNLKKASNRQDNGTSEISDGNARSEGATKSGGGGGLAEIMKKSREAA
ARRGAASSGASSSTSTFAEPPQFASSTSVSRGSTPKLDVEQRLKQLEVKMDKLLAHFNIT
Download sequence
Identical sequences A0A024GB20

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]