SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GEH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GEH5
Domain Number 1 Region: 683-919
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 7.2e-84
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000000378
Further Details:      
 
Domain Number 2 Region: 294-610
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-79
Family Protein kinases, catalytic subunit 0.00000082
Further Details:      
 
Domain Number 3 Region: 907-1058
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.34e-55
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00000192
Further Details:      
 
Domain Number 4 Region: 38-125
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000774
Family Regulator of G-protein signaling, RGS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024GEH5
Sequence length 1063
Comment (tr|A0A024GEH5|A0A024GEH5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI45279.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_061520 OC=Albugo.
Sequence
MNDLHDALQDAQYIGAVTNALRGPSAPFYTPTQAELQQFTSMQEQTYGTEWLHLENLLHQ
PLGFYFFSRYCDAEQYGSSKLLFLIEITKFRQLQSDDARLLHANEIWNRFCIDSHENSDK
VSNAFRSNCSTLPSIGSFSKQLNAAVCTNHLIVFWRKGESTLRRSETHQLYRQSVSEKSV
IGVSGGVLNRIEAILSMFIKLERKHQTLSSTRSLSPSSLSGKTSESSPRSTTSSCEAVMK
PGREPHTLRYLFDELEACVLWSLEHLHFKEFRASVFYNRLRIFLFLQNRPVSDQDFTKLR
VLGRGGFGMVTGCIKRTSAALYAVKVMNKKIIKQKHAERLCLAERKILAMVSSPFIVCLK
YAFQTPEELYLVLDLRTGGDLSFHLNRCRFTEQQVQFWAAQILLALEHLHANNIAYRDLK
PENILLDENGNCSLSDLGLAIEVTSTLTGRCGTRGYWAPEMLLRDVNNHRIAYTKVVDWW
SYGCLVYELLYGKCPFRTSRAKALHEDKQIAYDKATLELTPLYDPKYFSPQATDFIQKLL
VRDPKKRLGAHGAVEIRKQKFFSSIDWVQMESMSISPPFVPHNELNAASQSDIGSFDISS
ISGVQLNDQDRELYASWAYTSPDVFQKESIEYLEWESRHGPCSSDHTLFHKTMRWGFQSA
SMLTRLQRRIPTIHRSLSFLSGLPEEHVMLRDMVNQYVSKNLAPIAGELDREHRFPKKQI
QELGEMGLMGIDIEEKYGGAGLDYLAYAVALEQVSRGCASTCIILSVHSSLFCGPIAQFG
TEEQKQKHLIPFASGKKLGCFGLTEPGNGSDAGAASTTARETDDGFVINGTKAWTTNAHE
GDQVIIFATTDKAQKHKGISAFIVPMKTPGFSLGKKEDKLGIRASSTANLILEDVHIPKE
NLLGRRGEGFKIAMITLDAGRIGVAAQALGIAQASLDCAIRYAHQRKAFGQVLAKNSIIQ
SKLADMAMEIESARLLTYKAAMDKDNGLPITKIAAMAKLKASEVATMCAHQAIQILGGMG
YVSDMPAERHYRDARITEIYEGTSEIQRLVIATSLNKEFAQLN
Download sequence
Identical sequences A0A024GEH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]