SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GG30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GG30
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.02e-53
Family Phosphate binding protein-like 0.0000114
Further Details:      
 
Domain Number 2 Region: 231-310
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.44e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024GG30
Sequence length 348
Comment (tr|A0A024GG30|A0A024GG30_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI45723.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_066200 OC=Albugo.
Sequence
MAQTNEVIEMLQKLHPDVDFVVGQTNTLGDQVQDRHLSDLGTSIDSGLFTKSLEESLINK
TSDFAVHSLKDMPTTLPPGLVLATICKRASPEDAVIIHPKHKRKVLLHSRDLTCLTRTSQ
NISRLEELPEQSIIGTSSLRREALLRQMHPSFRMKTIRGNIQTRLSKLDDHSEYDAIVVA
ACGFRRGGLGNRIDQILPSKDFGYGVGQGSIGIECRADDTETLKMLRQIEHHESALCCKA
ERSLLYHLEGGCQISMGVHTTLHNGILTLTATVLSRDGTKSVEDMITGPCEEAVDLGEKL
ARRFLANNDAIILLGKIGKKRPLTYGDIEAPGDAAAAAKKMRSQGNVV
Download sequence
Identical sequences A0A024GG30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]