SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GNK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GNK9
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-22
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 
Domain Number 2 Region: 194-299
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000795
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024GNK9
Sequence length 336
Comment (tr|A0A024GNK9|A0A024GNK9_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI48375.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_094590 OC=Albugo.
Sequence
MSRTGKNEIESLLRVLDEKGRDLSIDDIVQNPISCGYLLDFCQKQYCAENLNFFMAVDKF
KDQCAILDFRDPEAAVTCKNLAETIWAEFLSTNSPSEVSLPSEDRLITMERLKFPGVYRQ
NLFEVAVKDAVKTLQKDTLGRFLKSPQFKDMESVFRAALEKMSTDTLEDAAFDNDLPTKI
VLTEERINSSSEYSLDEILNDKILFQEMLEYLENKFKAENLKCTHHILRFEHLADRKIGD
DLKAYAWNIYLYFLAPGSPFEVSCTALDRKFAQLRLGCPERSMFQPIKDSTLAVLKQDVK
PFCSQLEQKVLKEKLEKELPPTNRKKASFFSKVRVF
Download sequence
Identical sequences A0A024GNK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]