SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GQE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GQE8
Domain Number 1 Region: 1908-2153
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.57e-70
Family Rap/Ran-GAP 0.00012
Further Details:      
 
Domain Number 2 Region: 1674-1760
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000153
Family Regulator of G-protein signaling, RGS 0.0066
Further Details:      
 
Domain Number 3 Region: 243-266,533-626,865-1135
Classification Level Classification E-value
Superfamily ARM repeat 0.00000345
Family Armadillo repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024GQE8
Sequence length 2172
Comment (tr|A0A024GQE8|A0A024GQE8_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI49001.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_102550 OC=Albugo.
Sequence
MEMRRGENANISQTGSSGGGSNNGTGFSVSNTSASNTTPPGALSNSSGRRDPPEYTKKLS
KFYTSDRPPRKRLRNVLDFLKNPIQESGAANLVGMAVTALTGGSASKLNLTNALYSSETT
LLGSQETHHENKDANIENDAVAMNPTALAVRRILKDFWNDPGNASIFFLVVNDCITEMES
MYTPHENVTFRKIRQKKQVLDVDDWTDVFEGLEILIRNNRDLIRTGWKKNGFSLLFLKLL
QRENHSIIKKYAFRCLALYTDAMRSLSQFQLVEMHPTAGATMILTQVANSNGEYPFAGID
TSANGNNGIGLGHLGTGSTQTEPHATATAHRNTAGNTSEFSETLGSFPAAATGAQVFQSL
FNECVSSRACVHLDLMRESIDFSPFAGTTNSLPDKFMNDGTYVEGWVRPNPTQAEEPVDM
LRFLMDLSLEKDRNVTAPTEDKNAASTAPSPSTSNGKASSASETDRFEFWCELIMRFFMP
ILYPKVCHKVGLKEEGDTFGFFHHCPGSFQRVVARWLFKLRPRDDCMEIIWSKREFAEVV
METFRQRFMYRDSDLIMDAIKFYGAVCMETSQYIPIGMKQQMNETVRAMISHVSQLFHPS
VQLEDSKLLLHCIELLEVIAQRSLDEYTNMYLRKFVLSTIENCSAFRDPIHGGTILSAML
AITFHVWMHSNVINRASCSNSVWMELVLAIRRWLIHSSEQKFIVLENEIVACWRRELRFT
SCLVMYLLDQRQGTLKTTAEGTVLLPSEHPLTLNDSGSNATRSKDRRQGYIQSASAFLSA
KVQTARDAMILLDRVLHLLPPATMASVPPSLHYHVLQGLLQLIELWIDTAIAPPLQAPVK
GRSIKASKSALQAISPSTLIALFGKWFIPACESEHTEMINSRCVALVILCKLCTVRSLNP
LAKSHAALLVRILFCGITSSSGLVVSTVLQQASRVFTLNLDGTNVLIPAFLHTIDRVIIQ
NISDRAERSKYKTSEWTKELEAALQVAFSLLGTPKHFADQDLVNWKEKIQEIWRQSTDTA
SPYERKLLEDEWIALIDKVPEIKDSCYVILGRIFVRIRTLPFTDIESIQQRALWGLYSII
AMNLTIPIDQTPRVESRFLSAWIIHILDASQASDFTISMTALHILQDLATDYHAFIAELE
PGSLTERIVMTLAVFAQQQVEEASFEVQAEIEKNAIHSEAKNSFRAPTSSSSSNGVSTSS
RDSSRHSKQKTDASRNRSSPTTSPSLESSTGKSENPTLKLIFHKTSSIFDCLKVWVMARP
QILHDNDVKTILFDAIEAALIGVLPEGEWQKEVEKRRIRDRRLSIPLLFVGLQMRASLDQ
DATLTSNASVTPDTWLRCFEETALAAEGLLLHLLHHLNGYPSTGMDQMTSNCVEWSNGNA
EYEQQQPVLLRFVLMNAIIVTVVGSLESQCCRFIARDMTGLFTWELAPVGDIAATVTSLM
RDRIAAPSPSKVEVERPVKMCQSAAVRLEGKSSAQEESGNEMCAHCGLERTTTARSKDSG
LQVTQIAWDVEKRILGNTICTQPSNYVFHSKDTSTESTKSEVKSKAKSNAKAETKNSSSP
PKPKRICKCKSPKVTKRNRLVSICGLFDFQMYEPNLGSLNNERCLLDLVLDSIPILFRDC
CNSSDIIDKTLLGGRYAWQRYQYLEILTLEPPASTTSNWLLENDPTEANGLSFLERFIHD
EECFTLWKAFMLKTFPKKGKDWVEFCEAVKRFERTTVLNERLGQACLIYWEFFSLESPKK
LLTFPFAISGAIQSHIQSVQKSLRAVEGVKEKNVYASISFPGSLFQQAIGHLEQQLMDSG
VLDQFLTSLATEKNAKHKRKDISTSGVPTQLALFDAFSIMEINVRTAFQTLKLRKCSREL
VQMAQFRSLPPLFSPEPLHQRRVNAMDLCRLFLMQSNLIPCLHADNTSTNLQLLHDDGTS
GKLERSIKHLDKALTRETMKIGVLYVGPTQHTQQEILANDKGSSLYDRFLGLLGWKVDLL
HHAGFIGGLDCNPKSLSNGKMSIYYANAHTEVMFHVVTCMPTKENDVQQIDKKRHVGNDF
VHIVWNENDRRGYAAGTITSHFNDVQIVIYPLRSAKQGMFLLEIFSKEKLTSFGPLQSGM
VIDGLHDLAILVRQTAMNANRICRAQSALYLRPYPTRKKLVEEIIERYAVEYTDAQWMHW
LFTSEGNTFSSE
Download sequence
Identical sequences A0A024GQE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]