SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GV22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GV22
Domain Number 1 Region: 5-43,99-333
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.57e-68
Family Mitochondrial carrier 0.0021
Further Details:      
 
Domain Number 2 Region: 953-979,1183-1279
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-23
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 1320-1460
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000959
Family Regulator of G-protein signaling, RGS 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024GV22
Sequence length 1467
Comment (tr|A0A024GV22|A0A024GV22_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI50656.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_127330 OC=Albugo.
Sequence
MEFDQTLKKALAASAGAMISSVFVTPLDVAKVRLQSQIGLTSSKSYDLNRPKGSITDVLE
QCRCACKKKSARRTGLKSLFSKSHVAACCRRSSCTICVATPFRFNGTLQALRYIAHTEGI
RGLFSGLSPTIINSIPSTVMYYISYDFLHSEGIQRFPTLETAMPFLAGASSRVVAASITS
PIEMIRTRMQSSSGKQNMIKTFKNVIRNEGASSIFKGLQATLARDVPFSAIYWSCYETSQ
TRMNESFRNYDVGRVERAFVCGAIAGMVAALCTTPFDVVKTLQQVESAPKNASSRMILKQ
VIKNHGWAGAFSGLTARLARVTPSCAIMISTYELSKDKLECIFNKSLQISVMFSVGRLSY
VSRLGTEHAKYALRSGNHLPSITRCSGKPLNFAKVGHFVRRTTSDVSTIDNVPSNRWMAY
WLLGCASLVGSTIVVGGGTRLTRSGLSMVDWKPQGSLPPLSHEEWEDEFQKYKEFPEFQQ
RGSMTLSEFKYIYAWEYGHRMLGRVIGAVYGLPLAYFYVRNRIPIELKNRFAILLGLGAT
QGLIGWWMVRSGLEDHGRNQLEHRQEVRVSPYRLATHLTLAFTTFSMLTWTGLTLLQPPS
HFAHVREMLTPDVFKQTIRIRKYFHRAATLFGFTILSGAFVAGTDAGMAYNTFPKMNDEW
IPEEIFDLRPLYKNVFENIALVQLDHRILASSSLGAYSFVYALARRPQIWRQLPSQARGA
LNLSMGVVMSQVLLGITTLLNCVPIPLGIAHQTVPEFDANDSLEMTLNASVTTNKTMDDF
SSRSIGQATFSLRDSGKTSLAATVPFEGPPQYSNSVIAVRSCDSANEMADATEDELEDKL
SVQNSSAQIEDIMREDDSDEAEFDSDSSSQARAQSQGRSTAIEEKDDIVDDNDDETSLMR
QNRANSALKQFTKSNDHSKDQIIESDKHNDGHEADADIITASNSSRSFADKRISSDSFEP
HSAPKEKETQMRKAEHETQNIMKTSDENESIESKEIIPLHQTESKRGSNENEEKEAADVP
PNESHAPKDSNSNSLPQRIRLDEQAGYVRIYYQNKNFMSSTVFRVSDSTTILNVRRSMAK
KLSLVRAEFGFYIVVMVYPSSSSSTRSVSARTLHDDELIFPLITKETRNMTSNDEDSHAR
LKHRSRPPFKFVFKDSRGTPLNLQEDIENRSEPNSRILSAPTVLGNGIHCGYLQKASMKD
PNVWRKRWFVLKDDQLLYCKANTDQRDITSISLLNAYLAKARPELRVPFAFELRTPRRVY
QLCTTSKSDMLSWIHALHVQIGISTENHRLYQAEILISDDTVNKLDEHYVSMENEPPLLL
RILSREDTRRQFFDFVQSSNAQVLLDTWTECETFRRQGIARESGRPKRPPRDAWNHLKNI
IQAIQNLPVIRSKDAQELQEAFHSEQINRRLSLALHADSKVTEYPPFELLAPVQHQIFQA
LEKGPFREYLGQRGYRQLLERIMGRFF
Download sequence
Identical sequences A0A024GV22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]