SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GZ85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GZ85
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-23
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024GZ85
Sequence length 141
Comment (tr|A0A024GZ85|A0A024GZ85_9MICC) Ankyrin repeat family protein {ECO:0000313|EMBL:CCQ45270.1} KW=Complete proteome; Reference proteome OX=861266 OS=Pseudarthrobacter siccitolerans. GN=ARTSIC4J27_1208 OC=Pseudarthrobacter.
Sequence
MTDNAAVPNNNADVPSNSDDEAVALAHTLFQAAREGNSALLGAYLDAGAPATLTNAAGDS
LLMLAAYHGHAEAVQLILKHGAEANAANDRGQTPLAGAAFKGYTDVARVLLDAGADPDAG
SPSARAAAQMFARTEILNLLG
Download sequence
Identical sequences A0A024GZ85
WP_050054286.1.80505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]