SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024K422 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024K422
Domain Number 1 Region: 18-131
Classification Level Classification E-value
Superfamily ISP domain 6.42e-26
Family Rieske iron-sulfur protein (ISP) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024K422
Sequence length 132
Comment (tr|A0A024K422|A0A024K422_9MYCO) Rieske (2Fe-2S) domain-containing protein {ECO:0000313|EMBL:CDO90800.1} KW=Complete proteome OX=47839 OS=Mycobacterium triplex. GN=BN973_05200 OC=Mycobacterium.
Sequence
MSEETKRPEPRLAQGREHVVATVDEIPPGTHKLVPIGRHGVGVYNVNGKFYAIANYCPHE
GGPLCSGRARGRTIVDETVPGDAVMVRDLEFIYCPWHQWGFELATGTTAVKPEWSIRTYP
VRVVGNDVLVQA
Download sequence
Identical sequences A0A024K422
WP_036471495.1.51987 WP_036471495.1.88192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]