SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024KF65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024KF65
Domain Number 1 Region: 23-78
Classification Level Classification E-value
Superfamily EF-hand 0.000000081
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024KF65
Sequence length 98
Comment (tr|A0A024KF65|A0A024KF65_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:CDP52296.1} KW=Complete proteome OX=1380412 OS=Devosia sp. DBB001. GN= OC=Hyphomicrobiaceae; Devosia.
Sequence
MLMTAAAITLSAGGALAQNTPDFATTDGDKSGEVTFSELILQYPDVSQEQFDTADADKSG
GLNEKEFLMVVTPNTESVNENDDNQNKDDAAPATPPAQ
Download sequence
Identical sequences A0A024KF65
WP_035034002.1.53794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]