SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024P898 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024P898
Domain Number 1 Region: 139-282
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.88e-49
Family AadK C-terminal domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 1-135
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.27e-42
Family AadK N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024P898
Sequence length 291
Comment (tr|A0A024P898|A0A024P898_9BACI) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:CDQ25155.1} KW=Complete proteome; Reference proteome OX=195088 OS=Halobacillus karajensis. GN=BN983_03465 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Halobacillus.
Sequence
MRNEQEMMDLLLSVANKDERIRAVYMNGSRTNPNVTKDIFQDYDMVYVVTETDSFLKDTR
WLDVFGERLMLQEPDKNDQGTRLEDPDFYGYLMLFADGNRIDLHIEKRAHMQENYGVDKL
TIPLMDKDGCLPPLPAPTEEDYHVQKPSEGTYNACCNNFWWCQQNVAKSLWRDEVPYALF
MMERVIRQDLNQMVDWWIGTQTDFSVSTGKAGNYFKHYLPAEYWSLYKSTYASASPEQVW
EALFTAGDLFRELARAVAREFSYVYRIEDDQNMRVYLKQVRQLPPNAEEIF
Download sequence
Identical sequences A0A024P898
WP_035510491.1.21052 WP_035510491.1.39234 WP_035510491.1.82412 WP_035510491.1.89810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]