SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024Q8W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024Q8W2
Domain Number - Region: 10-66
Classification Level Classification E-value
Superfamily Prefoldin 0.000575
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024Q8W2
Sequence length 84
Comment (tr|A0A024Q8W2|A0A024Q8W2_9BACI) Uncharacterized protein {ECO:0000313|EMBL:CDQ38953.1} KW=Complete proteome; Reference proteome OX=1462526 OS=Virgibacillus massiliensis. GN=BN990_01233 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Virgibacillus.
Sequence
MTKDMVDDLLHAITDVMDELEDIQTNSQQIDELYSNLETKMNHMELHIHGLEKNIKHINE
KIAVVTEGNLQQGTKKLIARKVVY
Download sequence
Identical sequences A0A024Q8W2
WP_021289159.1.36263 WP_021289159.1.63854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]