SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R0R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R0R1
Domain Number 1 Region: 44-233
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.06e-70
Family Regulator of G-protein signaling, RGS 0.00000000579
Further Details:      
 
Domain Number 2 Region: 396-624
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-61
Family DBL homology domain (DH-domain) 0.000000601
Further Details:      
 
Domain Number 3 Region: 625-759
Classification Level Classification E-value
Superfamily PH domain-like 2.5e-38
Family Pleckstrin-homology domain (PH domain) 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024R0R1
Sequence length 912
Comment (tr|A0A024R0R1|A0A024R0R1_HUMAN) Rho guanine nucleotide exchange factor (GEF) 1, isoform CRA_e {ECO:0000313|EMBL:EAW57083.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_22327 OC=Catarrhini; Hominidae; Homo.
Sequence
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFP
AEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ
LGGNSVPQPGCT
Download sequence
Identical sequences A0A024R0R1 Q92888
gi|15011972|ref|NP_004697.2| NP_004697.2.87134 NP_004697.2.92137 HR4456 ENSP00000346532 ENSP00000346532 ENSP00000477339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]