SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R6L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R6L1
Domain Number 1 Region: 209-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000171
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 171-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000711
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  A0A024R6L1
Domain Number - Region: 65-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.028
Family EGF-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024R6L1
Sequence length 383
Comment (tr|A0A024R6L1|A0A024R6L1_HUMAN) Delta-like 1 homolog (Drosophila), isoform CRA_a {ECO:0000313|EMBL:EAW81712.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_25019 OC=Catarrhini; Hominidae; Homo.
Sequence
MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLA
VNIIFPEKIDMTTFSKEAGDEEI
Download sequence
Identical sequences A0A024R6L1
gi|74136023|ref|NP_003827.3| NP_003827.3.87134 NP_003827.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]