SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R712 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R712
Domain Number 1 Region: 269-412
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-33
Family cAMP-binding domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 135-266
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-33
Family cAMP-binding domain 0.000000174
Further Details:      
 
Domain Number 3 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000719
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024R712
Sequence length 418
Comment (tr|A0A024R712|A0A024R712_HUMAN) Protein kinase, cAMP-dependent, regulatory, type II, beta, isoform CRA_a {ECO:0000313|EMBL:EAW83391.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_17936 OC=Catarrhini; Hominidae; Homo.
Sequence
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Download sequence
Identical sequences A0A024R712 P31323
HR4718 9606.ENSP00000265717 gi|47132585|ref|NP_002727.2| NP_002727.2.87134 NP_002727.2.92137 ENSP00000265717 ENSP00000265717 ENSP00000265717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]