SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R909 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R909
Domain Number 1 Region: 52-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-47
Family Regulator of G-protein signaling, RGS 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024R909
Sequence length 205
Comment (tr|A0A024R909|A0A024R909_HUMAN) Regulator of G-protein signalling 4, isoform CRA_a {ECO:0000313|EMBL:EAW90729.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_15194 OC=Catarrhini; Hominidae; Homo.
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
Download sequence
Identical sequences A0A024R909 A0A2J8LM60 P49798 Q4R525
gi|5032039|ref|NP_005604.1| ENSMMUP00000006859 ENSMMUP00000006859 NP_005604.1.87134 NP_005604.1.92137 XP_017748918.1.44346 ENSP00000356885 9544.ENSMMUP00000006859 9598.ENSPTRP00000002692 ENSP00000356885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]