SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R939 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R939
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-46
Family Regulator of G-protein signaling, RGS 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024R939
Sequence length 211
Comment (tr|A0A024R939|A0A024R939_HUMAN) Regulator of G-protein signalling 2, 24kDa, isoform CRA_a {ECO:0000313|EMBL:EAW91232.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_41052 OC=Catarrhini; Hominidae; Homo.
Sequence
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
Download sequence
Identical sequences A0A024R939 G3QJV6 P41220
gi|4506517|ref|NP_002914.1| 9606.ENSP00000235382 ENSP00000235382 NP_002914.1.87134 NP_002914.1.92137 XP_003820643.1.60992 XP_004028122.1.27298 ENSP00000235382 ENSP00000235382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]