SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RE29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RE29
Domain Number 1 Region: 41-256,459-517
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.25e-34
Family Ankyrin repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 594-867
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-33
Family Ankyrin repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 368-410,489-522
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000017
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024RE29
Sequence length 1206
Comment (tr|A0A024RE29|A0A024RE29_ANAPH) Ankyrin {ECO:0000313|EMBL:EOA62236.1} KW=Complete proteome OX=1269275 OS=Anaplasma phagocytophilum str. CRT38. GN=CRT38_03182 OC=Anaplasmataceae; Anaplasma; phagocytophilum group.
Sequence
MLTEEEKKKSASALQAIITGDYESFQASVQGISSEGLNTPVDKEGRTLLHYAASSRNGNF
YGILVERGCVTNIRDAYGFTPEQAREKAGYARTQWYGADVNDPGVSRQLMTQAVQQSAKG
NMYAALAILDLVRNDDANIQVNEKGHSVLHLACIEGSNPSFTSSLMLKGCSLNIKDVDGN
TPLHTAAFSVGKNALGNLDVLCDKALIADVNAKGPGGNTPLHIATERMDHQKVEHLLSRL
SDISVANDAGETVCHIVAKQWPRRDVLPYIDKMQEAVSSNIEGNRECAEALIFPDKKGMS
AVQYAIRRHIPEAEKIFEKAINIADKVYGLASSEVESLFTCPNPEDASTLVHFVSSNGTP
NFDSLAKRVLEEAYHRYGEKPFTNLDVAGNAPIHAAAQKSTVGVFEQVVRCTPESVVNQL
APNGKAPIHMIVEDEPSHRSVSIKLQMLIGNVRNIPSINVPSPVTGETPAVAAYKGGNTE
DVKTMLRCNSMDVDARSHDGRTIIHYAAKDGNLEILQQALGRKSSYSKFPVKDGVPTPGV
YAIREASGGKVSLQALDMLMRYEPHPQHVAVEAVRTGAVGVLEHLITTEVISVNEEITTP
EGKKTTLTAEALTSGRYNVVKTLIKNSADVNASPEPAITLGIQGRCFQGSKAIKHLKRVV
EAGAHINTPTGSMSPLAAAVQAANEASNLKEANKIVNFLLHRGADLSSTEHTGTPALHLA
TAAGNHRTAMLLLDKGAPATQRDARGRTALHIAAANGDGKLYRMIAKKCPDSCQPLCSDM
GDTALHEALYSDHVAEKCFLKMLKESRKHLSDSSFKDLINTRQVANGDTLLHLAASRGFG
KACKILIKAGASVSVVNVEGKTPVDVADPSLKDRSWFFGESVVAMMAKRIQVPEGGFPPY
LPSDESPVPSLGSISSFESVSSISSSGSGLDTAGAEGSIYEEIKDTAKGTTKVESIYTTV
GAEGPRTPEGDDLYATVGAAITSEAQASDAASSKGERPESIYADPFDIVKPRRQERPESI
YADPFAAERTSSGVTTSGPKEEPIYATVKKGPKKSDTSQKEGTASKKVSSTVTVTKKKVK
PQVPTRTSSLPTKEGIGSDKGPSSGTGSSFASELQAQKGKLRPVKEGAPGPTKDKTPTSL
FSSEEFKKELTKAAEGLQGAVEAQKGDTGAEKAKQDPGMESGAPGSQPEAPQSEGLKPVK
GGGRGR
Download sequence
Identical sequences A0A024RE29
WP_044118470.1.66172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]