SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024RXK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RXK9
Domain Number 1 Region: 45-92,211-284
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000123
Family Regulator of G-protein signaling, RGS 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024RXK9
Sequence length 449
Comment (tr|A0A024RXK9|A0A024RXK9_HYPJR) Uncharacterized protein {ECO:0000313|EMBL:ETR97864.1} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_104193 OC=Trichoderma.
Sequence
MKILSLQYRRPKKVDNDTYRQRRETSEEAEGSVKSGLSGASSGIPDALSFDRIINGGTCP
PMAIRDFMNYLVYVEHAAENLQFYLWFKSYEKRFAEATGSEVALAPEWTQAMEDEAVARV
RKEQVDKMRREPAATAAIFNGTDFEKQAGDRRGNPFNTPPRSANAVSDHDSLAASWEALT
VGGNSNTHTTSNASSHTLAAEAFQAAGASLPFSIQPFHQEINRIITSYLIEGAPRQLNLA
AWEQRATVHALAYTTHPSAFRILFKSVDAALRLQSHPNFIRWSICNGNLPRVYFARFLGI
ALILVGFISAIIITLSKAGRGYRVLPLIAWALGMSTLVAAYKGMCIVLHGLHHRHVRPWE
LFTQDDGEEFGMCNMEPFGSNNSYEDEPWVVKYRERHLIRKIFDREIWIQEPALRQIQDT
IFCQALLAGFGFGLICMAIFLAVPGGHFF
Download sequence
Identical sequences A0A024RXK9 G0RAK1
XP_006962070.1.9351 51453.JGI74580 jgi|Trire2|74580|estExt_GeneWisePlus.C_20080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]