SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024S795 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024S795
Domain Number 1 Region: 1117-1246
Classification Level Classification E-value
Superfamily PX domain 1.44e-25
Family PX domain 0.00056
Further Details:      
 
Domain Number 2 Region: 677-824
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.98e-22
Family Regulator of G-protein signaling, RGS 0.003
Further Details:      
 
Domain Number 3 Region: 80-249
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.99e-20
Family TrmB-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024S795
Sequence length 1506
Comment (tr|A0A024S795|A0A024S795_HYPJR) tRNA(m7G46)-methyltransferase {ECO:0000256|HAMAP-Rule:MF_03055} KW=Complete proteome OX=1344414 OS=C-30) (Trichoderma reesei). GN=M419DRAFT_83538 OC=Trichoderma.
Sequence
MGNQRNKKVRRDQFRERRGQDGVVLLPRKKLYRQRAHANPFSDHLLEYPISPEQMDWSSY
YPAFVDEEAPREESKPPRMKQDVEVVDIGCGFGGLLVGLAPVLPDKLILGLEIRTTVTQF
VQERIWALRAQNADKLYQNAACIRANTMKFLPNFFKKSQLSKIFICFPDPHFKTKKHKAR
IVSTTLNSEYAYALRPGGIIYTITDVEALHEWMVEHLDAHPSFERVSKEEEESDECVKIM
LSETEEGKKVERNKGLKFVALFRPATMALKRRDAVLAAVAYFIAWGYAVSCFSALRWVGY
AFVGGIVISLLSLIAALVLTTQHPHSDRHAQPPRVSFLSSQRWNAEAEALRQRQAYHRDP
IDPSFPQASRALDELLELILRDFVRSWYSHISQNPIFENEVDKAIRQALLSLVDSLRNKD
LADVVTSRFVPILTAHFHDFYEAEKSVRGRKLNRSVTESEELDLAIASKFRDGKLHPAAS
LSFPDTKMVQQDYLRSLVERLLPRLLPKKLLSSRAVSIVVREIVGCAVLFPVVQLLGDPD
TWNQLIENLGRSMLQDRSTVRKLRAALDQHASPTPKSNKQAVAPRLAPGDNERKFEKFIR
AIRRVANLSDARRFRSEVASQLKRDSLQENQDPVYLRRLEMGKRLLDERVHHLAAGGNRH
APLPPPSAAPSSTSKLENASLVELLRDPAGLSYFMEYMDRQRLMPLVQFWLVVDGFRNPL
EDDGQDDELPSTLPMWTDSDRLDLLQIHQAYLSKPELNVPESAKKAVKEFLQAGVSATPA
EYYKARRAILRAQSAVLETMRSRYFEGFKKSDLYYKCLASQEMSRAAMSPPPPSHQNPST
SGRSHSYQSKPKPTARFAPLPAGPSRRLSGSISDLRSAHANGSGSDSLTASRRSLDDDRP
ANPLFDDDDLDNYGMMDSVQSLDQGLSRQQTPDKQVVQAVEQALTDILEHDRPQTAEDLR
ASLFDTEDNTSSLFGNDNDSNRGSFDAGRPQPTTKEAGKPTLSSLGLVSAASRIGVFVDD
DLFGDEDKYLPEGSDDVDEDGQSDEDDEIHEAAPGDLGLAEAITALTNDIDRLVAQEAVI
ESLTKKAELTNNAAELRILKKSKMSLQREIRRKELQRQQYVIQESDNSLYGRSEIRIKSI
QVGREDDGREFALYVIEVQRNAGEQMPASSWAVMRRYSEFHELHQKLRSRYPSVRNLDFP
RRRVVMKFQSDFLRKRRAALEKYLRELLLLPEVCRSRELRAFLSQSAIAPGADPMDRENK
KDMMTRLYDSVADGMEDILGNIPVLDQISVAGQNLIAAATNQLNTMPLNTGEETFPAAEA
EAELDAFENKEMEPFIKPICDIFLEVFELNKGNNWLRGRAVVVVLQQLLGGTIERRVREN
IKMAVQEESLLRYMGLLRSALWPDDELARDRKPRSAAEKKKTRTEASLMLATLVPDLAGN
VVGRVNAQAASRRLFATFNNSRLKYENPSNPLSSCVKVNVLLTRTCSSHLVFTILDEIVS
VLFDEA
Download sequence
Identical sequences A0A024S795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]