SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TCS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TCS6
Domain Number 1 Region: 632-678
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000129
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 231-284
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 2295-2352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 531-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000126
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 
Domain Number 5 Region: 383-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 6 Region: 485-531
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 7 Region: 1018-1062
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 8 Region: 2151-2197
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 9 Region: 2448-2493
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000942
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 10 Region: 681-727
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000102
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 11 Region: 1314-1369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 12 Region: 2642-2688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 13 Region: 2545-2591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 1567-1612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 15 Region: 1712-1758
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000051
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 16 Region: 2787-2831
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000523
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 2496-2542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 18 Region: 1956-2002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000068
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 19 Region: 581-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000824
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 20 Region: 2399-2445
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000876
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 21 Region: 2200-2240
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000101
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 22 Region: 877-919
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000127
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 23 Region: 1859-1901
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000128
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 24 Region: 2594-2639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 25 Region: 1461-1519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 26 Region: 971-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 27 Region: 1807-1861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 28 Region: 2350-2396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000327
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 29 Region: 435-481
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000379
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 30 Region: 1663-1709
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000405
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 31 Region: 923-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000562
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 32 Region: 1514-1568
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000068
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 33 Region: 828-872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000863
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024TCS6
Sequence length 2849
Comment (tr|A0A024TCS6|A0A024TCS6_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV91930.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_13717 OC=Aphanomyces.
Sequence
MRGAAGLVAAAHLASTAWGGQLDAFAFVHTDVYNTPEEFLTQVMADRAAIIWSTNATTPP
FQCTTTILWDYKPPNGCIVCTTAPTPVGSCTPSGLQMAYREVIKVGTNKEPCTGDPAQDT
LPEVITCVPDPRPGCVWEHVERTGWDNGALEPYGFIGATRYQVQADNPQLDCTLEPSRRV
IVDRLNPCDFDVLSDWGPCVNRRQERDIRIKRCPRNGAPACPVSRPCNPPNQDCVVSAWG
PWSACSNGVQIRTRTILTLPKGTGAACPATSKLSESRPCTAVDCVVSAWSPFVCDPATFV
QTRTRTIVVPPSNGGDPCPPLTHSAFCLHEDCIMSDWACDPAITTYTDNDSVPTTLTYRK
RTILRPALNGGAPCGPLVDDVPCNAVDCKLSEFGDWSACDASTGLRTRRRFVVTQPTNGA
KPCDHLSETKNCDPVPCVLTDWTAWGRCDNEKKIRTRTRSIVQPSLYGGESCSATVETTA
CDPKPCVMSPWTEWGECDLAYNLRTRTRTIVAPPQDDGLECPTDLRETLACPPKDCVMSE
WSEYSECDDFAGTRTRTREIVTAAENGGQACSTKLSETAPCLPVDCTVTSFGEFSVCDNG
VRTRVREVTRMNRYNGKACPALTETEPCVAKDCQWGPWGLWSDCDASTKVQTRARSIVSG
AANHGKPCVGSATETKPCLPVDCVVSGWSDFSECKDNRRTRTRTVVIPPANGGAPCDAPL
QDEDICRPQRCSVGGWSAFSPCTNGQKSRQRVVLDNPDNEECPPLTDTVSCTPCTPTFFD
DCTRSCVMGEWEAWSGCFDDGFQMRTRSRVGQAEDCPDDVEYRACKPVDCKQTEWSAWYC
DGTTALRTRKILQQPLYGGHECDDGLMERKPCSNAPTCTLSAWSEWSDCDYSTGVQTSTR
YVVSYGLACDDDMARTRPCPSTDCEVGDWSSFGPCNAVTGYRTRTREVKVPAAGDGMPCP
GLQDMLPCGGVDCQVSRWSDFGPCLNNVKKRTRTLLQPALFGGNACLPLEETVPCIPVDC
VVSAWSTWSACSNDLQTRTRHILRAPTNSGTPCGNLIETQSCESSECQLSAWSEWTSCNE
KTGLRYATRTVVREADIGKKPCDDMDLVKADKCAPVDCVLSAYSSFSDCDPVTFWSTRTR
KVVSAAKFGGKPCGALLDQKKCEPEDCKLTAPGPFSSCNCATDTKTAVRQIARPTRYGGE
PCGDLEVVEPCPPVDCAVSEFGPWTGCDKNAANLASEKSTRARIVTRPQQNCGKPCPDLI
ESKPCDPEPCVLSAWSPLSECDLKTHLKTQTRTVVSPPYWGGAPCDALIRTEACPARDCV
LSPWSALSECDLTTQKKTRTRSVVVAAEYGGAACSTELTQYEDCKPVNCKLTPFSDWICN
PTTKEKTRSRSIEVMPLYGGTPCQVLSETAPCDPVDCVLSEWSALSDCDVTKAVRTRTRK
MLTSPLYQGKACGALSETVPCPPVNCVVGAFSPWTTCDPLNFDPNAVQKRTRLVLTQPEN
GGTLCPALVETKPCNPLDCQVSCWSAWSVCDLATHLKTQTRTITRQPMWGGKACDALSQT
TPCPAQDCVMNAWSGWSPCNQATAKQTRVRTIQTPPANGGAACGDVIETKDCKPVNCVLS
AYGPWTCDPVTKTKTRSRTVVTPAAFFGTPCGVLSETAPCDPIDCALSSWSPLSACDCKT
QVQTQTRTIVVEPQYGGKACEPTVATVACPTVHCAVNEWSSWSGCDGTSNVFTRTRTVLT
PAQHCGTPCPALSETQSCPPVHCQLSAWSAPSSCNLDTHVKTQTRTILVAPQWGGEACGI
LTRTIPCPPRHCVVGDWSPWSDCDLSRAEKKRSRRIQITPEYGGDPCGNIIETQECKPVH
CQVTAWGPYGPCNAVTGLRTRTRTIQVAPENGGQSCPGLSEDLLCDPVDCRLSEWTVGEC
DVTSQRRPRTRTVVIAPLYNGKPCDSLVAYDACPPVHCQVSAFTDWSKCDYTTRLQKRTR
TITVAPQNGGTACGPVTETRRCDPVDCVITPYAFGECDPITGNRKGIAQVATEAQFGGAA
CPPLVKLIPCDPVDCVMGPWSAFSNCCLRTYVQTRTRSIVTPAQYGGKGCGPTIDTIECK
RQDCVLTAFGPWGVCDPVTNMRSRTRSVHIPAANGGTPCGCLVESELCPRIDCKLSMWGD
WSVCDPKTGTQRRFRQVLVLPENGGCACGDTTETKKCAPVHCQVSAFSSWSECNITTSHR
TRTRQVLTAPLYGGNPCPVLKMRARCPPVDCKVSPFGSFTACCPDTRTKTRSRIVTQEPL
NGGLLCPDLVESVSCAPVDCVVSDWTDWSPCNSNDAATSVSSRTRTVLRWPVNGGTQCPG
LTETKPCNPVDCQVSCWSPFSACDPTKRVMTRTRKVTRPASNGGQPCPPLSESVRCPPVD
CTISEWSAWSSCNPNTYHRTRKATIVTNSQYGGRECPPLIEHEKCPAVNCAVSDWCDWSS
CDASGKKTRTRTVTTPSANGGLSCPGLVETKACDPVHCVLDAWGPWSKCNPSTRQRSRDR
KVLVAPAYGGHDCDDVTETETCVPIDCRVGPFSEWGPCNEATSTRSRTRPIVVAPQNGGA
ACPATTETQPCPACHCEMSPWTSWGLCDDYGYQVRTRTVLVAARYGGVPCGPVKEKQKCA
PVHCQMGPWGPWSACTCTTMTSVRSRSILVPAAFGGAECGASTETQPCPGVDCKLGAWSA
WGACIRGYQTRVRPIEVAPVGNGAKCGVASQKKPCDPVDCELSPPGPWNACNPCTGTKSR
DISIKTYPAYGGRPCPETTERAPCDAVNCAVSDWTPWSVCSFGKQFRTRCVTRQPAYDGA
ACPHLREVQGCCVVATTVQKWSPFFSVVA
Download sequence
Identical sequences A0A024TCS6
XP_008879567.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]