SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TFQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TFQ3
Domain Number 1 Region: 13-63
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000485
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 2 Region: 69-114
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000554
Family Ovomucoid domain III-like 0.0096
Further Details:      
 
Domain Number 3 Region: 121-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000018
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024TFQ3
Sequence length 222
Comment (tr|A0A024TFQ3|A0A024TFQ3_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV92873.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_12906 OC=Aphanomyces.
Sequence
MQFKVFALAAVVASVAGQCEMGCIDQYAPVCGSNGKTYSNECQLRVDACTTKSKIEIASQ
GECQGSNSGNCEKQCTREFDPQCGSDGITYGNKCLLSVATCKNSSVRLERAGECGTSSPS
TCKKGCPEILKEVCGSNGKTYSNECELQNAACDIPSLKVATEGACVATSSASPANNAADD
ASNKAVTTTPAPAVPAAVKSASMGLVTSTAAFCVAAVACVLP
Download sequence
Identical sequences A0A024TFQ3
XP_008878394.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]