SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TKA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TKA5
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000106
Family Ubiquitin-related 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024TKA5
Sequence length 106
Comment (tr|A0A024TKA5|A0A024TKA5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV94458.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_11787 OC=Aphanomyces.
Sequence
MSLYLRVKRRNQTFFVLAEPHDTFLKVKETLASILALTSPNQVQLWHTNKQKELLDAATV
ADQEIENDAIIFLCLKKENSEVWEDIQVAKLEQDHEGNNHDHASKD
Download sequence
Identical sequences A0A024TKA5
XP_008876773.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]