SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024TPD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024TPD9
Domain Number 1 Region: 250-375
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000324
Family Regulator of G-protein signaling, RGS 0.0073
Further Details:      
 
Domain Number 2 Region: 147-243
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000078
Family Regulator of G-protein signaling, RGS 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024TPD9
Sequence length 955
Comment (tr|A0A024TPD9|A0A024TPD9_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV95481.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_10952 OC=Aphanomyces.
Sequence
MSFLKKPDNFALESWLFGEDIDTKRPSALQVRSAPTSRPHSPSLGSNGSGPVLMFNPKLV
AAATDAANKIQDTYKKMSTKALNSQYPMPISKHFRKYLKAKQQHSLAKTVEEDELFLSPS
SYTRLRSYTPASLPEITMEGKTNYHQVLLFLLELEQQKAVGALPPLLKLFNKYFTRASEF
CISETLELTNELEQLVLANIQQPDIGWLGFRPLQKLAFKRLAREELPRFIKSDAYLKMLK
EVEQTAAFVPMERFLTHRRAAHYFLLFLMQQRQHFELYFWLHVEYVLLPCSSSQPSLFWS
LTADLVAKAAVDSTAILDGTKATLTTAVASSSRQSPDAITTALAALKNAQKDIVRLLSAS
WYDRFVKSRLYVLALHDRKSKKVLDSDSEDEAAAPSYSEYDTDVSIPTSSLVHHEEESED
DSDDDASDEIGDEDDGSSNDSNSCRRRRMLRSDRLDLESILRSTNLPPGLQVHYRPNYVV
SANTLSDYLTGASTSNGVDSIVLFKTSLERSSGLEVSYVRRDKTAVTTPEAQRKIQDLAK
RIQPFLVPHGFLTSAKEASHATMLPFLVLQNGHDDHLYGVSYFTSCNLPPPKGVATVSDE
SPSPSSPSEENRYGIHGICLLSTYPLLETLRKLMIQHVRRHPGDACVVPDNARELYEAPT
PSTPTTHQGSPGTPLVFTSPPTPQRPRLMTGMSFLDLPPPARLDFSLDELFHRLSSALVL
EVVANALLEHSVIFVSNSYTSLTMCAESVRSLLHPFTWCHIYIPLLPKSLLSYLHCPTPI
MVGVHQSTTSRDDLPVPSDASATIVVDLDRGTIEYLGTRRVEWGSMGLQDSCPSKHHIRI
VDAFHDAKCRLDALLSWRLCVDAVDDQVIPDMQDTGNLDQQRRSIFHDLVYSLLDHHNTA
SLVVGDAHDSVIMFDEMKFTALRPAHEAPFIESLVRTQSFSEIISTHRIGTSCEA
Download sequence
Identical sequences A0A024TPD9
XP_008875674.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]