SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024U0T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024U0T9
Domain Number 1 Region: 177-247,282-347
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.59e-27
Family cAMP-binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 472-610
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000265
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 
Domain Number 3 Region: 359-477
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000131
Family cAMP-binding domain 0.0075
Further Details:      
 
Domain Number 4 Region: 7-70,106-146
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000636
Family cAMP-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024U0T9
Sequence length 655
Comment (tr|A0A024U0T9|A0A024U0T9_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW00036.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_07472 OC=Aphanomyces.
Sequence
MGNDVSCVDVLRNTPFAMFLSPEVVQDISVCFTPIKFKPGATIAFTKQEFLIVARGSVDV
STILPHAQKKVKVMELLCKKRVGDIVTHCATRTSRSKLHRKSYIEQHERRYSGGKKFALM
LDLVTVTADPADGCVLLRLNRDKFVRVRALHMMHRPNVTTQFSINKATRTAEDDWRLVTT
VADDQIADYLAGVPFFSDVKSSRLVALAGLCTYMVARKDEVVCKENDLGDKFYICITGVL
AVTVENDVDAVPKVSHRSMSIVAGSQFRRSVDSHRPSVSMSQVLIRRIADGSYFGEISLI
LNMKRSATVTAVDDSLLVYIDARAFRNFLKVCPDVRMQIEQVIISRLLQIASKSSTATFL
AAMSMENHQRLAQLGQLLEVARGTKLIVHHDDPVFYIVLNGKVEVDYDLPSGHLFVALGP
GGYLNELSMILQTGSLIQATVREDSVLLALHSIQFHMFFSTLPEFFAEFSLRYLQHDASL
EHVINHYDAHELWLVYLEGRPDSYEERIRHITNGVLFCEDADEFTMSCESLSREARVEQA
KQVVEMYFDKGCERPVALSRSLREDIYAAIEASSIDDTLFSHARREIIDLMDASVLADFK
RSTKFASVLTKLVCLPDIPVHLSSAMKAHLNFHVFKHRPSHAVTNNYAWVSATPR
Download sequence
Identical sequences A0A024U0T9
XP_008871061.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]