SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UFA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UFA5
Domain Number 1 Region: 120-177
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000161
Family Chromo domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024UFA5
Sequence length 191
Comment (tr|A0A024UFA5|A0A024UFA5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW05091.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_04119 OC=Aphanomyces.
Sequence
MLKRSQQRCTICTVTYQHEVRSCAQQARGRHDNKNKVNFTTFAVGDYVLVGSVVQRSNKL
ALQWRRPNQVVRAVTDHVMETQQLVPPFGVSTYHSCRPKMYQDSSIEVTEDLINQIAYCD
GGFHVERLEKVRLTNGEYQVQVKWMGLGDEEVLWELARNPLDAIPVVFTKWCKTHKSAKH
VAAMMKNLGLL
Download sequence
Identical sequences A0A024UFA5
XP_008866529.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]