SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024ULY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024ULY7
Domain Number 1 Region: 192-504
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-20
Family Ankyrin repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000017
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024ULY7
Sequence length 511
Comment (tr|A0A024ULY7|A0A024ULY7_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW07205.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_01794 OC=Aphanomyces.
Sequence
MMNKWRLSEDLFKQIVLYQRGIPAYMLLLVRLLYRVYTPKSKDFAMTTSIIQRWWSKWGV
TRLADLFRHLPRIKGMMLLFATWNNVPDVIDYFVVNNINIRSYGGRLLDVAASRNHLDIL
QKLHHLGHNGCTTEAMDCAASFGNMAMIMFLKTHRQEGASEAATLTAAASGHLDMLQFLH
EQVGTRWHKDAMDKAAAAGHVHILEYLHHRAQTCTHVAMDLAAAHGHFAVVKWLHSHRKP
ATKMAMHNAAVNGHFYIVRFLHTHRNEGCVKVMETLTNSSATTSPSNTITEAAKHGHLGV
VQYLHHYDLSNVGSETLVGAVTMGHLAIVEYLLLYANGFSAVHVNKVLDIAATNNHVAFV
DWLATTFGATGTDGAIDGASGQGHWAMAQHLHERFGVGCTASAIDMAVAGNHFAAATFLL
DHLCHVSPETMDLAAEHGHVEMAQLLFSKSTAGCTTNALTLAARNGHLNMVVWLHDTKLV
LGCTDEAMEGARQNGHFRIVQWLEQRYRARP
Download sequence
Identical sequences A0A024ULY7
XP_008863298.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]