SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UMB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UMB3
Domain Number 1 Region: 531-577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 59-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024UMB3
Sequence length 959
Comment (tr|A0A024UMB3|A0A024UMB3_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW07601.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_02077 OC=Aphanomyces.
Sequence
MLHTRASKVRLWILATATSGLALAAYRPIDVVGVTDPVLLARIEGYMPPICSSLYGDSEH
WTDWSICSAKCGAGQQVRYLTNAGIENLQSNGCEISIDKRNCTGTMCPRDCQYSDWLENN
GTNGGWGVCDKATGSQARKRVEIMSAANGGKSCPELWGAPTQTKNCPIDCEGNYGPWETK
CNGKNGTVTRPFIVTVAPLNGGADCPALFDTMDCNPACTEIPWGQYSECSPITGNRTRTR
DVPVDANWLKITTILKENKCPTIDVQPCNVHCQLGKWTDEKVATCNSSTGLKTLTRRIVQ
PARFCGTPCNSTEHDTLLTKTVPCNVPCILDSWGPWTCDKSTGLATRIRAVLQAPLNNGT
TCGITSQTQDCRSVTCPNCAKTCEPTDWVSDNVCNVTTCMSKKTRTRKYPVRDADKPCSL
EAFEPCTADAIMGPWSAWSECDEHARRTRSRGIVSPACNWGGVASHTTETQSCQSICLPR
HNPWPVDKDGQEVWGPCNQATGMQTRRRVIVKPPTADQEPCRTSESRTCAVNCVLDAWSP
WSKCEANSGLRNRTRRILQPMLNGGSQCGPTQETEKCPMACLTGEWSPWSPPDDKCVCHS
TRDQLTPAINGGPCILKQFDPSCVQNCEVGSWNATGKCHVAGPRAGYRRLTRSVLARPCN
GGASCGATESWEPCDVHCAMGNWSSFGQCDLETQTQTAERTILHTNFGNGKSCGATVKTR
PCGACADLLTPYQYGVCNPAVGTRTGIASWKYPPKQGQQCALRVKQRCAVDCKLSAWKAG
PCNVRGPLAGKKSFTRNVLVQPLNGGKQCEALEKVEKCRVDCKPTNKWGPWGQCLPNGLM
NRTLLIDYPAQHGGSNDACTVMESKACAVDCIIDTSTGEVTRGSLNGGLTCQEVAAAAGL
DGDYSDVSGSSHFSVLASQHKEVVMSMVAAGGVGLMFMVGALQRRYQAHRQSYSSMAQA
Download sequence
Identical sequences A0A024UMB3
XP_008863694.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]