SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UNE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024UNE7
Domain Number 1 Region: 325-443
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000633
Family Regulator of G-protein signaling, RGS 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024UNE7
Sequence length 538
Comment (tr|A0A024UNE7|A0A024UNE7_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW07715.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_02164 OC=Aphanomyces.
Sequence
MVPIIVASLRSQLVLCEAREMGNGANDTAVPTVPSGAIERLLLPPDGIVRTIIVAILGLS
FYLPFAILLYYCNRHKPAIRYRNPVEMTFTATAAFAYGFARCMGSLFVDKFSCTFRLLSF
GIPLQLGLMGYLLAELRVVLTFNLTELMVAHAERRKVNRHNLSHLHSLLRRGLLSVYRIL
IHILWNTPLVIILYSNDYSSYNGEQCPSRLNHKVTTLFATEFLVIVVASMVLSFKMSKVV
DNFGLRRSFQASGRILFLWFCIYFPILAFFFDTDVVLSYRLDLFMDILIAHTFIWIHIVL
PLREAYMMPDHDVDGAAFKGTTGILDAYLHTPEGFKAFSTFAKSEFRLECVLAWKTLVDY
RIESPDHLSAFEIYELHIAPAAPLSLEKDISPSILKRYVLAFEANSKYSIAPEEMVRDVN
YFDVLLDAIMDKIVVETLPRFQQHALGANWGDFVSKYNTQMALDKMLNRDQCEPFLQPNR
TMPTIKGELLRSSGRLGPIESRRESMLRSSVGGDTLGDDDKPQEHNAKRVNAMDVRHS
Download sequence
Identical sequences A0A024UNE7
XP_008863808.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]