SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024USJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024USJ8
Domain Number 1 Region: 1632-1911
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 4.18e-78
Family Rap/Ran-GAP 0.0000517
Further Details:      
 
Domain Number 2 Region: 134-189,341-432,550-758,797-912
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000096
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.072
Further Details:      
 
Domain Number 3 Region: 1434-1519
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000121
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024USJ8
Sequence length 1931
Comment (tr|A0A024USJ8|A0A024USJ8_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETW09486.1} KW=Complete proteome; Reference proteome OX=157072 OS=Aphanomyces invadans. GN=H310_00057 OC=Aphanomyces.
Sequence
MQSASSSAASSNVPSAASALPQLDMKKLSRFFAEDKPPRKRLATALEFLKTSTGEQHELF
WGEVAHGSMFFSVLHAYLTELETMYVAPEKKNLIDKMRTKKFQTDDWTDVFEGLEVLIKS
NKALLASGWQHNRFLQIFQKLLLADNIAYIKKYAFRCLALYSDILMDTDFGLRNTAQLLT
TSVTQTSSSNSVDAVNIGFGFSHLDLLAESIDFSPYASGNSNVILPARVYTVGSVLGWER
VGPTQAEEPVDMLKYVMDLSLERSENITDVDIHRFLFWCDVLMHSYMPLLYPKTCVEVGL
KDKADKFGFFHHCPGSFQRVMARWLYKLRSKPKFMDALWLRKEYVDVIMETMRQRFAYRD
PELILDGIKFYSQLCKGTQYIPPAMKESFHEMHRAIIAHVSQIFHPSVHFDDPNIFIVGI
ELLELLSQQPLHIHSFAVLRKAILATTDASFFLRDMPPGQSILVPMVAAVYHTWMHGMVQ
PNGASVDVWAELGTMVRKWLTSPSVSTAFATELVRRWKVEVNTISAILQWFYSPHQHTAA
DKQHDDLPKEFVSTFVSQHIAPTVDTALVVLDRLLHVMSPSTTMPSLKPHLVLLVQESVR
DLVIMWVNKIPALGISPSTLVSLFGEWFLPSCEPPMSSDFEAAQCVALETLCLVSTASCN
NNTDMLPSHVAMFCRVIHAAIHDTTKINVISTVVRQASTIFGRCASGIHVLIPAVLHAIE
ALTEHHTSPATALAYGPDSKVDCLSCIQLLFGLLSLPGQYPNLAHESWQAKLRNVGPATK
GTSRAPTALPLLAEFDAELHTVAAGCFQRLVDFDGSEFASTTDVQQRALWGLYLLVVLQL
RSSSHPTLVKSYVIYLCDTCASQDVVLAQTALAAVHALHHYHAALLALEPGLVQHIVMAL
SLLVQQQVENASTVIRDHLEGSPTDQLPPPLHHGQRGGNPVALGSPTDNLGPDTSDVAVG
RGRKRSNSWAAPDKQPSSGSESVLGANLNLPRQQSRGSEVMSSVLKTIVAKSNAIFESLT
DWLMSCTSLLHDEAVLKLLFQALEAALIGSIPTQSEWQIVVEEARKRKRNMDTPLLFLGL
AMRVSLDPDRHKTSLQCFSDIAAAAEGFLMHLLHHLHGFPSPAGMDQFVSTCTEFDDTAN
DAVTSLSFVYLNSIVLTVVGGVDAPTARIVVRDITGTYTWDAVAVSTGLPVQPSGVDALS
MQAALMPATTSAEHDKHPWDRPIPGQHDGECRERLEVMMDHAVAHANMTVPTSNMCTICG
GRILKPSAPSAPPLAPTNALVPFPVAKKILVKGNSLPSMPQYVFHTESHPGLNSGSNFDV
YLCQCSSTLHQDPTSTPVVSAASPTAAVPICNLFTIDADQQYIGSLDHERCLLELLVDSI
PMHYRDCGGDLIDKTLLGGRYTMQKYLDMEWDERRTRTPVGPMHKDSSSEPGFSFFQRLL
HDDECYAYFKLYLAEERDRGRSLIEFCDALKKYERSFDGNDRLSQASLLYWEYLSSESNF
SVKFPYGIASKVQNAIQQAAASASDNRPAHVQQLPLTLFQAALDHVEVTCFENGGLLDRF
ITSLNDLLAKKTSGPPVANDGDNWANMPIPHQLMLYDAFNVMELNVRICAETLKVKATTN
GIFNPTRTALATPTTPSTAAQPSTRLAPLDMCRLFLGHVGILPNDFLATHHQVQLLDNGV
KLERSLKHLDKAPSRETMKIGVVYVGPNQSSQQEILRNDCGSPAYEQFLRELGWEVDLAT
HRGFVGGLDVNPKSLSNGPKTLYYASSTAELIFHVVTMMPTRDADPQQIDKKRHVGNDYV
HVVWSDNLRAYNQATITSNFNFVQVVLFPLKHNTYDGLVLVEVLTKPNVPLFGPLMTGMV
VTQSELPDLVRQTVMNANRACRQQTQWYMAPYTTRRKLIEEVIERYAMDYSEKSMLTSLF
KIPSPSEGHSL
Download sequence
Identical sequences A0A024USJ8
XP_008860897.1.42657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]