SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024UYQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024UYQ1
Domain Number - Region: 36-147
Classification Level Classification E-value
Superfamily Serpins 0.000318
Family Serpins 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024UYQ1
Sequence length 189
Comment (tr|A0A024UYQ1|A0A024UYQ1_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW15898.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_05226 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MIPLFKIGIVLIRQVSKPISGYIKKKAIDNKNFKSICIYCGKKYYFFEQYIQKKFYNSNT
TNINYSSYISENKSVNVGSEILGETIIFLVAALIIIAEYKRNSLKEAKKEFILNHKLETL
KLQVLELQKENDEIMKIVMPTKQNIRNNRSYDIENKNFFKDIYNKYVSKQNTISQNNKEQ
NDNNSIKQN
Download sequence
Identical sequences A0A024UYQ1 A0A024VZG8 A0A024WH84 A0A024WZ95 A0A0L7K787 Q8IKN8 W4I958 W4IWR9 W7F6X8 W7FB92 W7JFX7 W7K0R6
PFHG_00711T0 gi|124810018|ref|XP_001348740.1| gi|23497639|gb|AAN37179.1| 5833.PF14_0566-1 PF14_0566 XP_001348740.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]