SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024V1K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024V1K8
Domain Number 1 Region: 100-149
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.68e-17
Family Ribosomal protein S27a 0.005
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000437
Family Ubiquitin-related 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024V1K8
Sequence length 149
Comment (tr|A0A024V1K8|A0A024V1K8_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW16379.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_04636 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKILINIPYDESLCLESSNINNIKNVKEQIFELKGIPYELQKLYKNGRHLEDEELLEIDE
SDYAYTLNLNFGLLGGAKKKKKKVYKKPKKEKHKKKKVKLAVLKFYKVGDDGKVFRLKRQ
CDNCAPGTLMASHFDRDYCGRCHLTIMKK
Download sequence
Identical sequences A0A024V1K8 A0A024W146 A0A024X0N7 A0A0L1IGY8 A0A0L7K740 W4IBF6 W4IUG9 W7FF39 W7FR30
PFHG_00412T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]