SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024V357 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024V357
Domain Number 1 Region: 19-161
Classification Level Classification E-value
Superfamily SNARE-like 1.28e-33
Family Synatpobrevin N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 155-218
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.26e-20
Family SNARE fusion complex 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024V357
Sequence length 221
Comment (tr|A0A024V357|A0A024V357_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW16997.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_04102 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSDFSRDMSNNENSKKIALYSILIYKYESSNQPIFLTSALDLSSFPFFHRSSLKEHIYFH
ARLVCGRTQKGTREVIELESGIGHLHIYTNKENNISVLVLSTSSYPLRIAFSLIDLTHKL
FAQKCRGMYEHVRQDLKEGMLIQNELNDLLKKYQNPSEADKLSRVQKDLDEVKDVMLKNI
EDLLQRGEKLDDLMKKSQDLSNSSYQFYRQAKKNNQCCSLY
Download sequence
Identical sequences A0A024V357 A0A024VFB6 A0A024WK12 A0A024X3K1 A0A0L1ID45 C0H5D3 Q0ZAG4 W4ID16 W4IX68 W7F9R2 W7G0T1 W7K1F5
XP_002809030.1.26446 gi|225631972|emb|CAX64311.1| gi|296005416|ref|XP_002809030.1| MAL13P1.135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]