SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VBS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024VBS8
Domain Number - Region: 22-139
Classification Level Classification E-value
Superfamily GINS helical bundle-like 0.00575
Family PSF1 N-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024VBS8
Sequence length 207
Comment (tr|A0A024VBS8|A0A024VBS8_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW19929.1} KW=Complete proteome; Reference proteome OX=1036723 OS=Plasmodium falciparum Vietnam Oak-Knoll (FVO). GN=PFFVO_01139 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTAKSPCLDILPFIFREEQISNRIQTFPTETMKKAYLELKGYFEQYKIYAEKLINFSGSM
NDENQRKEKLIIKLRCEYYAVIFSQASKLLHEYINFRNRLILELAINVNGLINSIHPNII
QRLNEDEQKELQKYCENIRSERTRSKLQNKFTVCFLNDLIIEDLNYEGVQKDMKGRNVFY
SAGLKVSVFEDKALDLQKCEWAKILRD
Download sequence
Identical sequences A0A024VBS8 A0A024WCJ3 A0A024WW87 A0A024XEE9 Q8I3M9 W4I6J6 W4ITI7 W7FJR7 W7FNN2 W7JGC3 W7KKJ5
gi|124506389|ref|XP_001351792.1| gi|23504721|emb|CAD51599.1| 5833.PFE1175w-1 XP_001351792.1.26446 PFE1175w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]