SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024VNV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024VNV5
Domain Number 1 Region: 171-364
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.44e-51
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000971
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily SNARE-like 3.36e-33
Family Clathrin coat assembly domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024VNV5
Sequence length 367
Comment (tr|A0A024VNV5|A0A024VNV5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW30389.1} KW=Complete proteome; Reference proteome OX=1036724 OS=Plasmodium falciparum FCH/4. GN=PFFCH_02154 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVISQFYILSPRGDTIINRDFRGDIIKGSAEVFFRNVKLYKGDAPPVFYLNGINFTYLKS
NSLYFVVTSLFNISPSYLIELLHRLLKIFKDFCGQITEELIRTNFILIYEIIDEIIDYGY
LQNSNTEYIKNLIHNEIATNNNTVKKFANLPNFSIKNTNTLPSNASQKPIQINDKKNEIF
IDIVEKINLIMNSNGEIVYSYIDGVIQIKSYLLGNPFIKIALNDDLYIKNIHHDNSNNII
IDDCNFNHLVNLSQFEKDKILSLYQPDGECVLMNYRINNNFKAPFKIYANVIYNQNHTVE
LCIRIRLDIPSQYTCTNVFVYCNLCKHITNVHLDLNTNSDLFSAQYISNENKLLWTIKKF
KVKKKYI
Download sequence
Identical sequences A0A024UZ15 A0A024VNV5 W4IS71 W7EZ55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]