SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024W1X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024W1X2
Domain Number - Region: 69-169
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0412
Family Regulator of G-protein signaling, RGS 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024W1X2
Sequence length 261
Comment (tr|A0A024W1X2|A0A024W1X2_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW34573.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_04715 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNRIYLFVFLFVCCFVSSVIGMNVVIPRNKESRTKRVIKGIKKKYKGFTERYRKSFHLKD
EDVIGAYSMQAYYFFDKNIEHMFKWRLFYNFCKKSPSPCNYFKLRKEFKRIYEGSTFTLK
KYVSEVNIIFNQFIKEYSTVRFNVDLKQNHIANLSYTPNLTTQIMKSLTSLINDQLMENE
LKNPTWKLSFNYLTGTKVLTITVPSAVPGLNFFIYYYITTFKYYYSKLFGTLGNIYFRFQ
GSIKKHNVGYFSIERRYERKT
Download sequence
Identical sequences A0A024W1X2 W4ICA5 W7F2P8 W7FP29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]