SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024W2D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024W2D5
Domain Number 1 Region: 13-161
Classification Level Classification E-value
Superfamily SNARE-like 1.01e-35
Family Sedlin (SEDL) 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024W2D5
Sequence length 163
Comment (tr|A0A024W2D5|A0A024W2D5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW34733.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_04532 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNKSTGSMSSNLSQVFVLTIIGKGDIPLYEADLSINSKRDISEHLTQFIIHQSLDSLDEI
VWKSSSMFLKNIDSFNNYSVSAYCTPGHMKFLLLYKNRNEGGTNLTNTNIYIPSDDHIKS
FFETVHENYIKVLLNPLYEPNGIITSSLFDQNVHLAAKKYLHQ
Download sequence
Identical sequences A0A024V350 A0A024VII9 A0A024W2D5 A0A024WLK6 A0A024X4L6 A0A0L0CVV5 A0A0L1I4B3 A0A0L7KDT6 A0A0L7M2G1 W4IWZ5 W7FGX6 W7FQP5 W7J6M8
PFHG_02833T0 PFDG_02750T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]