SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024W3L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024W3L5
Domain Number 1 Region: 26-66
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024W3L5
Sequence length 69
Comment (tr|A0A024W3L5|A0A024W3L5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW35489.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_03787 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEDSFNLIDKNNLDEETTNIKNENMKYMESHPELKDLLNDFISSILLHTPDDIFKYANEY
FSNFKKKTN
Download sequence
Identical sequences A0A024W3L5 A0A024WMK6 A0A024X5T6 A0A060S0Y1 A0A2I0BZ85 C6S3K6 W7FJ79 W7FLI7 W7J9W5
gi|254945369|gb|ACT90630.1| gi|258549157|ref|XP_002585482.1| 5833.PFL0746c-1 XP_002585482.1.26446 XP_019970196.1.2076 PFL0746c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]