SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024W575 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024W575
Domain Number 1 Region: 89-269
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.97e-27
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.033
Further Details:      
 
Domain Number 2 Region: 4-100
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000000981
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024W575
Sequence length 284
Comment (tr|A0A024W575|A0A024W575_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW35316.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_03967 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MHMIKNSDIDCCIVVENCEDKNSYLYILKVIKSAINLIYPSLTINIIKASVPIAKIYKEE
TNICDISINNTVAIVNTKFVSSICNIDERVTIINRIIKYWAKQKNINNRSQGTFSSYALF
LLTYYFFQNINNPLLPSYKSIERENAESFDINSEYFFLQDHVEMPFYTNIEDIRNKFPNL
QKNKEDVSKLLYGFFEFYSNDICKNGITLDIYNNQIIENKDMTANIYCPITKKIVNTYSI
NTWKKMFEKFQAAYDKLKNGDSLNIICEETKDNTPNRKMDLKGR
Download sequence
Identical sequences A0A024W575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]