SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WAR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024WAR3
Domain Number - Region: 16-66
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00115
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WAR3
Sequence length 110
Comment (tr|A0A024WAR3|A0A024WAR3_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW37683.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_01609 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEKEVQCQIEEENLYEQINVPEKINDLLVEYTKNIILHNPSKGCENENESKMKAYEWSRD
YFKKKLLEDNTTNNNISYKNIQVHNIDNSYNSSSIKNKIEKEMERINFKI
Download sequence
Identical sequences A0A024VAM2 A0A024WAR3 A0A024XAP0 A0A0L1IBS9 A0A0L7K702 C6KTA6 W4IK65 W4ISM7 W7FQT0 W7JS68 W7KJ83
5833.PFF1310c-1 PFF1310c PFHG_00623T0 gi|46361222|emb|CAG25083.1| gi|86171649|ref|XP_966253.1| XP_966253.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]