SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WDX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WDX6
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 1.57e-56
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00000085
Further Details:      
 
Domain Number 2 Region: 139-271
Classification Level Classification E-value
Superfamily Translational machinery components 1.74e-48
Family ERF1/Dom34 middle domain-like 0.0000012
Further Details:      
 
Domain Number 3 Region: 273-413
Classification Level Classification E-value
Superfamily L30e-like 2.06e-46
Family ERF1/Dom34 C-terminal domain-like 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WDX6
Sequence length 427
Comment (tr|A0A024WDX6|A0A024WDX6_PLAFA) Eukaryotic peptide chain release factor subunit 1 {ECO:0000313|EMBL:ETW38957.1} KW=Complete proteome; Reference proteome OX=1036725 OS=Plasmodium falciparum Tanzania (2000708). GN=PFTANZ_00301 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEDHDANVEQWKIKRLIKKLENAKGNGTSMISLIIKNKDEVSRINKMLADELGTASNIKS
RVNRLSVLSAITSTQQKLKLYNKTPPKGLVVYCGTVITEDGKEKKMSIDFEPFRPINTSL
YLCDNKFHVEALKELLESDDKFGFIIVDGNGALFGTIQGNTREVIRRFTVDLPKKHGRGG
QSALRFARLRLEKRHNYVRKVAEVATSVFITNDKVNVTGIVLAGSADFKNDLLNSDMFDQ
RLFAKVIKIVDISYGGDNGFNQAIELSSEALQNVKFIQEKKLIGKFFEEIAQDTGKVVYG
IDDTLKALEIGAVELLILYEGLDIIRLTTKNPVTNQTKTMHISPCDEKQESLYKENNVEL
EVVEKISLTDWVIGNYKKYGASLDFVTNKSQEGAQFQKGFGGFGGMLRYKIDLNLYDEDV
ESDVELF
Download sequence
Identical sequences A0A024WDX6 A0A024XF91 A0A060RN86 A0A0L1IDV7 A0A0L7KE08 A0A151LWH8 O96203 W7FIR8 W7G296 W7JZW5
gi|124801199|ref|XP_001349629.1| gi|3845214|gb|AAC71899.1| PFB0550w 5833.PFB0550w-1 PFHG_03088T0 XP_001349629.1.26446 XP_012761000.1.2076 XP_018643779.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]