SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WVF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WVF7
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Histone-fold 1.95e-43
Family Nucleosome core histones 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WVF7
Sequence length 132
Comment (tr|A0A024WVF7|A0A024WVF7_PLAFA) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_01462 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSAKGKTGRKKASKGTSNSAKAGLQFPVGRIGRYLKKGKYAKRVGAGAPVYLAAVLEYLC
AEILELAGNAARDNKKSRITPRHIQLAVRNDEELNKFLAGVTFASGGVLPNIHNVLLPKK
SQLKAGTANQDY
Download sequence
Identical sequences A0A024V9Y6 A0A024VH42 A0A024WVF7 A0A024X1C6 A0A060RUV4 A0A0L1ICM1 A0A0L7K6Y3 A0A151L451 A0A2I0BQ11 C6KT18 P40282 W4IJQ7 W4IV17 W7FRJ1 W7FT38 W7JFY7
XP_012761991.1.2076 XP_018639034.1.24268 XP_966163.1.26446 PFF0860c 5833.PFF0860c-1 PFHG_00594T0 gi|46361129|emb|CAG24993.1| gi|86171188|ref|XP_966163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]