SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WXI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WXI9
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily Histone-fold 1.01e-41
Family Nucleosome core histones 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WXI9
Sequence length 158
Comment (tr|A0A024WXI9|A0A024WXI9_PLAFA) Histone H2A {ECO:0000256|RuleBase:RU003767} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_00583 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEVPGKVIGGKVGGKVGGKVLGLGKGGKGKTGSGKTKKAPLSRASRAGLQFPVGRVHRML
KSRISSDGRVGSTAAVYAAAILEYLTAEVLELAGNATKDLKVKRITPRHLQLAIRGDEEL
DTLIKATIAGGGVIPHIHKALMNKVPLPPTAQKKPKKN
Download sequence
Identical sequences A0A024WDY3 A0A024WXI9 A0A024XDA7 A0A060RNL0 A0A0L1IFB1 A0A151LVZ8 A0A2I0BTA7 O97320 W4IPR1 W7GCD1
gi|124505075|ref|XP_001351279.1| gi|4494010|emb|CAB39069.1| PFC0920w 5833.PFC0920w-1 XP_001351279.1.26446 XP_012761280.1.2076 XP_018643644.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]